Catalog No: AVARP13054_T100
Price: $0.00
SKU
AVARP13054_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PMCH Antibody - N-terminal region (AVARP13054_T100)

Datasheets/ManualsPrintable datasheet for AVARP13054_T100
Product Info
Predicted Species ReactivityMouse, Rat, Cow, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PMCH
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Mouse: 78%; Pig: 85%; Rat: 78%
Peptide SequenceSynthetic peptide located within the following region: RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL
Concentration1.0 mg/ml
Blocking PeptideCatalog # AAP30733 (Previous Catalog # AAPP01390)
ReferencePresse, F., et al., (1990) Mol. Endocrinol. 4:632-637.
Gene SymbolPMCH
Gene Full NamePro-melanin-concentrating hormone
Alias SymbolsMCH, ppMCH
NCBI Gene Id5367
Protein NamePro-MCH
Description of TargetMCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation.
Uniprot IDP20382
Protein Accession #NP_002665
Nucleotide Accession #NM_002674
Protein Size (# AA)165
Molecular Weight19kDa
Protein InteractionsMCHR2; MCHR1; PCSK5; PCSK7; PCSK6; NPY; PCSK2; PCSK1; FURIN; CPE;
  1. What is the species homology for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse, Rat, Cow, Pig".

  2. How long will it take to receive "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PMCH Antibody - N-terminal region (AVARP13054_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    This target may also be called "MCH, ppMCH" in publications.

  5. What is the shipping cost for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PMCH Antibody - N-terminal region (AVARP13054_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PMCH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PMCH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PMCH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PMCH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PMCH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PMCH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PMCH Antibody - N-terminal region (AVARP13054_T100)
Your Rating
We found other products you might like!