PMCH Antibody - N-terminal region (AVARP13054_T100)

Catalog No: AVARP13054_T100

Product Info

• Predicted Species Reactivity: Mouse, Rat, Cow, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMCH
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Mouse: 78%; Pig: 85%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL
• Concentration: 1.0 mg/ml
• Blocking Peptide: Catalog # AAP30733 (Previous Catalog # AAPP01390)

Target Info

• Reference: Presse, F., et al., (1990) Mol. Endocrinol. 4:632-637.
• Gene Symbol: PMCH
• Gene Full Name: Pro-melanin-concentrating hormone
• Alias Symbols: MCH, ppMCH
• NCBI Gene Id: 5367
• Protein Name: Pro-MCH
• Description of Target: MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation.
• Uniprot ID: P20382
• Protein Accession #: NP_002665
• Nucleotide Accession #: NM_002674
• Protein Size (# AA): 165
• Molecular Weight: 19kDa
• Protein Interactions: MCHR2; MCHR1; PCSK5; PCSK7; PCSK6; NPY; PCSK2; PCSK1; FURIN; CPE;