PMAP36 Recombinant Protein (Pig) (OPCA03302)

Catalog No: OPCA03302

PMAP36 Recombinant Protein (Pig) (OPCA03302) in SDS-PAGE showing the molecular weight of approximately 20.25 kDa.

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Host: Pig
• Additional Information: Relevance: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
• Protein Sequence: VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 130-166 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA.Storici P., Scocchi M., Tossi A., Gennaro R., Zanetti M.FEBS Lett. 337:303-307(1994)
• Gene Symbol: PMAP-36
• Gene Full Name: antibacterial peptide
• Alias Symbols: antibacterial peptide PMAP-36;myeloid antibacterial peptide 36;PMAP36.
• NCBI Gene Id: 100170124
• Protein Name: Antibacterial peptide PMAP-36
• Description of Target: Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.
• Uniprot ID: P49931
• Protein Accession #: NP_001123437.1
  
• Nucleotide Accession #: NM_001129965.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 20.3 kDa