Search Antibody, Protein, and ELISA Kit Solutions

PLXNA2 Antibody - N-terminal region (ARP49932_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49932_P050-FITC Conjugated

ARP49932_P050-HRP Conjugated

ARP49932_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Plexin A2
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ11751, FLJ30634, KIAA0463, OCT, PLXN2
Description of Target:
PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLXNA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLXNA2.
The immunogen is a synthetic peptide directed towards the N terminal region of human PLXNA2
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-PLXNA2 (ARP49932_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PLXNA2 (ARP49932_P050) antibody is Catalog # AAP49932 (Previous Catalog # AAPP29580)
Printable datasheet for anti-PLXNA2 (ARP49932_P050) antibody
Target Reference:
Budel,S., Schizophr. Res. 99 (1-3), 365-366 (2008)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...