- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for PLSCR3 Antibody (OAAL00761) |
---|
Predicted Species Reactivity | Human|Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 4D11 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | ELISA|WB |
Reconstitution and Storage | -20°C |
Immunogen | PLSCR3 (NP_065093.2, 74 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | SGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPC |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | PLSCR3 |
---|---|
Gene Full Name | phospholipid scramblase 3 |
Alias Symbols | ca(2+)-dependent phospholipid scramblase 3, phospholipid scramblase 3, PL scramblase 3. |
NCBI Gene Id | 57048 |
Protein Name | Homo sapiens phospholipid scramblase 3 (PLSCR3), transcript variant 1, mRNA|phospholipid scramblase 3 [Homo sapiens] |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_065093.2 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_020360 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PLSCR3 Antibody (OAAL00761)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "PLSCR3 Antibody (OAAL00761)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "PLSCR3 Antibody (OAAL00761)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PLSCR3 Antibody (OAAL00761)"?
This target may also be called "ca(2+)-dependent phospholipid scramblase 3, phospholipid scramblase 3, PL scramblase 3." in publications.
-
What is the shipping cost for "PLSCR3 Antibody (OAAL00761)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PLSCR3 Antibody (OAAL00761)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PLSCR3 Antibody (OAAL00761)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PLSCR3 Antibody (OAAL00761)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PLSCR3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PLSCR3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PLSCR3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PLSCR3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PLSCR3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PLSCR3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.