Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

PLPP1 Antibody - N-terminal region (ARP42721_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42721_T100-FITC Conjugated

ARP42721_T100-HRP Conjugated

ARP42721_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
phospholipid phosphatase 1
NCBI Gene Id:
Protein Name:
phospholipid phosphatase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133882 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in synthesis of glycerolipids and in phospholipase D-mediated signal transduction. This enzyme is an integral membrane glycoprotein that plays a role in the hydrolysis and uptake of lipids from extracellular space. Alternate splicing results in multiple transcript variants of this gene.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLPP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLPP1.
The immunogen is a synthetic peptide directed towards the N terminal region of human PPAP2A
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rat: 93%
Complete computational species homology data:
Anti-PPAP2A (ARP42721_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PLPP1 (ARP42721_T100) antibody is Catalog # AAP42721 (Previous Catalog # AAPP11105)
Printable datasheet for anti-PLPP1 (ARP42721_T100) antibody
Target Reference:
Tanyi,J.L., Clin. Cancer Res. 9 (10 PT 1), 3534-3545 (2003)

Evseenko, D. et al. Lysophosphatidic acid mediates myeloid differentiation within the human bone marrow microenvironment. PLoS One 8, e63718 (2013). IHC, WB, Guinea Pig, Human, Mouse, Rat 23696850

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...