Size:100 ul
$319.00
In Stock
SKU
ARP42731_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42731_P050-FITC Conjugated

ARP42731_P050-HRP Conjugated

ARP42731_P050-Biotin Conjugated

PLOD2 Antibody - middle region (ARP42731_P050)

Catalog#: ARP42731_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PLOD2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-PLOD2 (ARP42731_P050)
Peptide Sequence Synthetic peptide located within the following region: IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PLOD2 (ARP42731_P050) antibody is Catalog # AAP42731 (Previous Catalog # AAPP24956)
Datasheets/Manuals Printable datasheet for anti-PLOD2 (ARP42731_P050) antibody
Sample Type Confirmation

PLOD2 is strongly supported by BioGPS gene expression data to be expressed in DU145

Target Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol PLOD2
Official Gene Full Name Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2
Alias Symbols LH2, TLH
NCBI Gene Id 5352
Protein Name Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
Description of Target PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. Mutations in the coding region of this gene are associated with Bruck syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Swissprot Id O00469-2
Protein Accession # NP_891988
Nucleotide Accession # NM_182943
Protein Size (# AA) 758
Molecular Weight 84kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PLOD2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PLOD2.
Protein Interactions ITGB1BP2; SUPT5H; CSDE1; SF1; UGP2; TPP2; VASN; RNF123; NUSAP1; SAMHD1; DNPEP; GANAB; SWAP70; XPO7; PACSIN2; FAF1; HSPH1; SEC23A; PRMT3; FARSB; USP15; RANBP3; SET; RPL24; PTPN12; NCL; NARS; JUP; GART; XRCC6; AP2B1; gag-pol; UBL4A; OS9; FBXO6; UBC; VHL; Fa
  1. What is the species homology for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "PLOD2 Antibody - middle region (ARP42731_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PLOD2 Antibody - middle region (ARP42731_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    This target may also be called "LH2, TLH" in publications.

  5. What is the shipping cost for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "84kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PLOD2 Antibody - middle region (ARP42731_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PLOD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PLOD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PLOD2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PLOD2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PLOD2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PLOD2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PLOD2 Antibody - middle region (ARP42731_P050)
Your Rating
We found other products you might like!