Search Antibody, Protein, and ELISA Kit Solutions

PLOD2 Antibody - middle region (ARP42731_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42731_P050-FITC Conjugated

ARP42731_P050-HRP Conjugated

ARP42731_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of human PLOD2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-PLOD2 (ARP42731_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IKGKTLRSEMNERNYFVRDKLDPDMALCRNAREMTLQREKDSPTPETFQM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PLOD2 (ARP42731_P050) antibody is Catalog # AAP42731 (Previous Catalog # AAPP24956)
Printable datasheet for anti-PLOD2 (ARP42731_P050) antibody
Sample Type Confirmation:

PLOD2 is strongly supported by BioGPS gene expression data to be expressed in DU145

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Gene Symbol:
Official Gene Full Name:
Procollagen-lysine, 2-oxoglutarate 5-dioxygenase 2
Alias Symbols:
NCBI Gene Id:
Protein Name:
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
Description of Target:
PLOD2 forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.The protein encoded by this gene is a membrane-bound homodimeric enzyme that is localized to the cisternae of the rough endoplasmic reticulum. The enzyme (cofactors iron and ascorbate) catalyzes the hydroxylation of lysyl residues in collagen-like peptides. The resultant hydroxylysyl groups are attachment sites for carbohydrates in collagen and thus are critical for the stability of intermolecular crosslinks. Some patients with Ehlers-Danlos syndrome type VIB have deficiencies in lysyl hydroxylase activity. Mutations in the coding region of this gene are associated with Bruck syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLOD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLOD2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...