Catalog No: ARP53218_P050
Price: $0.00
SKU
ARP53218_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PLEKHH2 Antibody - C-terminal region (ARP53218_P050)

Datasheets/ManualsPrintable datasheet for anti-PLEKHH2 (ARP53218_P050) antibody
Product Info
ReferenceMehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Prostate (formalin-fixed, paraffin-embedded) stained with PLEKHH2 antibody ARP53218_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
IHC Information: Human Prostate (formalin-fixed, paraffin-embedded) stained with PLEKHH2 antibody ARP53218_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PLEKHH2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-PLEKHH2 (ARP53218_P050) antibody is Catalog # AAP53218 (Previous Catalog # AAPP30702)
Gene SymbolPLEKHH2
Gene Full NamePleckstrin homology domain containing, family H (with MyTH4 domain) member 2
Alias SymbolsPLEKHH1L
NCBI Gene Id130271
Protein NamePleckstrin homology domain-containing family H member 2
Description of TargetPLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
Uniprot IDQ8IVE3
Protein Accession #NP_742066
Nucleotide Accession #NM_172069
Protein Size (# AA)1493
Molecular Weight168kDa
Protein InteractionsLPXN; LYN;
  1. What is the species homology for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    This target may also be called "PLEKHH1L" in publications.

  5. What is the shipping cost for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "168kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PLEKHH2 Antibody - C-terminal region (ARP53218_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PLEKHH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PLEKHH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PLEKHH2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PLEKHH2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PLEKHH2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PLEKHH2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PLEKHH2 Antibody - C-terminal region (ARP53218_P050)
Your Rating