PLAU Recombinant Protein (Human) (OPCA01023)

Catalog No: OPCA01023

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL
• Source: E.coli
• Tag: N-terminal 6xHis-tagged
• Reference: Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004)

Target Info

• Gene Symbol: PLAU
• Gene Full Name: plasminogen activator, urokinase
• Alias Symbols: ATF;BDPLT5;plasminogen activator, urinary;QPD;u-PA;UPA;U-plasminogen activator;URK;urokinase-type plasminogen activator.
• NCBI Gene Id: 5328
• Protein Name: Urokinase-type plasminogen activator
• Description of Target: Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
• Uniprot ID: P00749
• Protein Size (# AA): Recombinant
• Molecular Weight: 21.3 kDa