Search Antibody, Protein, and ELISA Kit Solutions

PLA2G7 Antibody - middle region (ARP81177_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PLA2G7
Official Gene Full Name:
phospholipase A2 group VII
NCBI Gene Id:
7941
Protein Name:
platelet-activating factor acetylhydrolase
Swissprot Id:
Q13093
Protein Accession #:
NP_001161829.1
Nucleotide Accession #:
NM_001168357.1
Alias Symbols:
PAFAD, PAFAH, LP-PLA2, LDL-PLA2
Description of Target:
The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
Protein Size (# AA):
441
Molecular Weight:
50 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLA2G7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLA2G7.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G7
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PLA2G7 (ARP81177_P050) antibody is Catalog # AAP81177
Datasheets/Manuals:
Printable datasheet for anti-PLA2G7 (ARP81177_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...