Search Antibody, Protein, and ELISA Kit Solutions

PLA2G6 Antibody - middle region (ARP97771_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PLA2G6
Official Gene Full Name:
phospholipase A2 group VI
NCBI Gene Id:
8398
Protein Name:
85/88 kDa calcium-independent phospholipase A2
Swissprot Id:
O60733
Protein Accession #:
NP_001004426.1
Nucleotide Accession #:
NM_001004426.1
Alias Symbols:
GVI, PLA2, INAD1, NBIA2, iPLA2, NBIA2A, NBIA2B, PARK14, PNPLA9, CaI-PLA2, IPLA2-VIA, iPLA2beta
Description of Target:
The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Protein Size (# AA):
806
Molecular Weight:
88 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PLA2G6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PLA2G6.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G6
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LTGTLSDRQPAELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PLA2G6 (ARP97771_P050) antibody is Catalog # AAP97771
Datasheets/Manuals:
Printable datasheet for anti-PLA2G6 (ARP97771_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...