Size:100 ul
$125.00
In Stock
SKU
ARP67742_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP67742_P050 Unconjugated

ARP67742_P050-FITC Conjugated

ARP67742_P050-Biotin Conjugated

PLA2G2F Antibody : HRP (ARP67742_P050-HRP)

Rating:
100% of 100
Catalog#: ARP67742_P050-HRP
Domestic: within 1 week delivery | International: 1 week
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the following sequence YCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEI
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-PLA2G2F (ARP67742_P050)
Peptide Sequence Synthetic peptide located within the following region: YCGLGGRGQPKDEVDWCCHAHDCCYQELFDQGCHPYVDHYDHTIENNTEI
Concentration 0.5 mg/ml
Blocking Peptide Available upon request
Datasheets/Manuals Printable datasheet for anti-PLA2G2F (ARP67742_P050-HRP) antibody
Gene Symbol PLA2G2F
Official Gene Full Name phospholipase A2, group IIF
NCBI Gene Id 64600
Protein Name Group IIF secretory phospholipase A2
Swissprot Id Q9BZM2
Protein Accession # NP_073730
Nucleotide Accession # NM_022819
Protein Size (# AA) 168
Molecular Weight 19 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PLA2G2F.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PLA2G2F.
  1. What is the species homology for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PLA2G2F Antibody : HRP (ARP67742_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PLA2G2F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PLA2G2F"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PLA2G2F"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PLA2G2F"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PLA2G2F"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PLA2G2F"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PLA2G2F Antibody : HRP (ARP67742_P050-HRP)
Your Rating