ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: OAAL00435
Size:100 ug
Price: $349.00
SKU
OAAL00435
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PKMYT1 (OAAL00435) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid
ClonalityMonoclonal
Clone2A3
IsotypeIgG2a Kappa
HostMouse
ApplicationFN
Reconstitution and StorageStore at -20C or lower. Aliquot to avoid repeated freezing and thawing.
ImmunogenPKMYT1 (NP_004194.3, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Peptide SequenceSynthetic peptide located within the following region: PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT
FormulationIn 1x PBS, pH 7.4
Gene SymbolPKMYT1
Gene Full Nameprotein kinase, membrane associated tyrosine/threonine 1
Alias SymbolsMYT1, PPP1R126
NCBI Gene Id9088
Description of TargetThe protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase preferentially phosphorylates and inactivates cell division cycle 2 protein (CDC2), and thus negatively regulates cell cycle G2/M transition. This kinase is associated with the membrane throughout the cell cycle. Its activity is highly regulated during the cell cycle. Protein kinases AKT1/PKB and PLK (Polo-like kinase) have been shown to phosphorylate and regulate the activity of this kinase. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Protein Accession #NP_004194.3
  1. What is the species homology for "PKMYT1 Antibody (OAAL00435)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PKMYT1 Antibody (OAAL00435)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "PKMYT1 Antibody (OAAL00435)" provided in?

    This item is provided in "Liquid".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PKMYT1 Antibody (OAAL00435)"?

    This target may also be called "MYT1, PPP1R126" in publications.

  5. What is the shipping cost for "PKMYT1 Antibody (OAAL00435)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PKMYT1 Antibody (OAAL00435)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PKMYT1 Antibody (OAAL00435)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PKMYT1 Antibody (OAAL00435)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PKMYT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PKMYT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PKMYT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PKMYT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PKMYT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PKMYT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PKMYT1 Antibody (OAAL00435)
Your Rating
We found other products you might like!