PKMYT1 Antibody (OAAL00435)

Catalog No: OAAL00435

Size:100 ug

Detection limit for recombinant GST tagged PKMYT1 is 1 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between CCNB1 and PKMYT1. Huh7 cells were stained with anti-CCNB1 rabbit purified polyclonal 1:1200 and anti-PKMYT1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2A3
• Isotype: IgG2a Kappa
• Host: Mouse
• Application: FN
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: PKMYT1 (NP_004194.3, 400 a.a. ~ 499 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: Synthetic peptide located within the following region: PASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTVGSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: PKMYT1
• Gene Full Name: protein kinase, membrane associated tyrosine/threonine 1
• Alias Symbols: MYT1, PPP1R126
• NCBI Gene Id: 9088
• Description of Target: The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase preferentially phosphorylates and inactivates cell division cycle 2 protein (CDC2), and thus negatively regulates cell cycle G2/M transition. This kinase is associated with the membrane throughout the cell cycle. Its activity is highly regulated during the cell cycle. Protein kinases AKT1/PKB and PLK (Polo-like kinase) have been shown to phosphorylate and regulate the activity of this kinase. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
• Protein Accession #: NP_004194.3