Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57788_P050-FITC Conjugated

ARP57788_P050-HRP Conjugated

ARP57788_P050-Biotin Conjugated

PKM2 Antibody - N-terminal region (ARP57788_P050)

Catalog#: ARP57788_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PKM2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Complete computational species homology dataAnti-PKM2 (ARP57788_P050)
Peptide SequenceSynthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PKM (ARP57788_P050) antibody is Catalog # AAP57788 (Previous Catalog # AAPP45012)
Datasheets/ManualsPrintable datasheet for anti-PKM (ARP57788_P050) antibody
Gene SymbolPKM
Official Gene Full NamePyruvate kinase, muscle
Alias SymbolsCTHBP, MGC3932, OIP3, PK3, PKM, TCB, THBP1, PKM2
NCBI Gene Id5315
Protein NamePyruvate kinase isozymes M1/M2
Description of TargetThis gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Swissprot IdP14618
Protein Accession #NP_002645
Nucleotide Accession #NM_002654
Protein Size (# AA)531
Molecular Weight58kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PKM2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PKM2.
  1. What is the species homology for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PKM2 Antibody - N-terminal region (ARP57788_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    This target may also be called "CTHBP, MGC3932, OIP3, PK3, PKM, TCB, THBP1, PKM2" in publications.

  5. What is the shipping cost for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PKM2 Antibody - N-terminal region (ARP57788_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PKM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PKM"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PKM"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PKM"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PKM"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PKM"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PKM2 Antibody - N-terminal region (ARP57788_P050)
Your Rating
Free Microscope
Aviva Tips and Tricks
Aviva Validation Data
Aviva Travel Grant