Search Antibody, Protein, and ELISA Kit Solutions

PITX2 Antibody - N-terminal region : FITC (ARP35634_T100-FITC)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35634_T100 Unconjugated

ARP35634_T100-HRP Conjugated

ARP35634_T100-Biotin Conjugated

Gene Symbol:
PITX2
Official Gene Full Name:
Paired-like homeodomain 2
NCBI Gene Id:
5308
Protein Name:
Pituitary homeobox 2
Swissprot Id:
Q99697-2
Protein Accession #:
NP_000316
Nucleotide Accession #:
NM_000325
Alias Symbols:
RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, IGDS2, IRID2, Otlx2, RIEG1
Replacement Item:
This antibody may replace item sc-111686 from Santa Cruz Biotechnology.
Description of Target:
The PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
Protein Size (# AA):
324
Molecular Weight:
36kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PITX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PITX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
Predicted Species Reactivity:
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-PITX2 (ARP35634_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
LEF1; Hoxa1; WDR5; SMAD3; HDAC1; CTNNB1; ZNHIT3; TRIM25; HERC5; PDLIM1; PITX2; PROP1; KAT5; Pou1f1; MSX2;
Blocking Peptide:
For anti-PITX2 (ARP35634_T100-FITC) antibody is Catalog # AAP35634 (Previous Catalog # AAPP07881)
Datasheets/Manuals:
Printable datasheet for anti-PITX2 (ARP35634_T100-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Martin,D.M., et al., (2004) Dev. Biol. 267 (1), 93-108
Publications:

Hatou, S. et al. Functional corneal endothelium derived from corneal stroma stem cells of neural crest origin by retinoic acid and Wnt/β-catenin signaling. Stem Cells Dev. 22, 828-39 (2013). WB, Bovine, Mouse, Pig, Human, Dog, Rabbit, Rat 22974347

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...