Size:100 ul
$249.00
In Stock
SKU
ARP35634_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35634_T100-FITC Conjugated

ARP35634_T100-HRP Conjugated

ARP35634_T100-Biotin Conjugated

PITX2 Antibody - N-terminal region (ARP35634_T100)

Catalog#: ARP35634_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-111686 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Complete computational species homology dataAnti-PITX2 (ARP35634_T100)
Peptide SequenceSynthetic peptide located within the following region: SAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PITX2 (ARP35634_T100) antibody is Catalog # AAP35634 (Previous Catalog # AAPP07881)
Datasheets/ManualsPrintable datasheet for anti-PITX2 (ARP35634_T100) antibody
Target ReferenceMartin,D.M., et al., (2004) Dev. Biol. 267 (1), 93-108
Publications

Hatou, S. et al. Functional corneal endothelium derived from corneal stroma stem cells of neural crest origin by retinoic acid and Wnt/b-catenin signaling. Stem Cells Dev. 22, 828-39 (2013). IHC, WB, Cow, Dog, Human, Mouse, Pig, Rabbit, Rat 22974347

Gene SymbolPITX2
Official Gene Full NamePaired-like homeodomain 2
Alias SymbolsRS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, IGDS2, IRID2, Otlx2, RIEG1
NCBI Gene Id5308
Protein NamePituitary homeobox 2
Description of TargetThe PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.
Swissprot IdQ99697-2
Protein Accession #NP_000316
Nucleotide Accession #NM_000325
Protein Size (# AA)324
Molecular Weight36kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PITX2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PITX2.
Protein InteractionsLEF1; Hoxa1; WDR5; SMAD3; HDAC1; CTNNB1; ZNHIT3; TRIM25; HERC5; PDLIM1; PITX2; PROP1; KAT5; Pou1f1; MSX2;
  1. What is the species homology for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PITX2 Antibody - N-terminal region (ARP35634_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    This target may also be called "RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, IGDS2, IRID2, Otlx2, RIEG1" in publications.

  5. What is the shipping cost for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PITX2 Antibody - N-terminal region (ARP35634_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PITX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PITX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PITX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PITX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PITX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PITX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PITX2 Antibody - N-terminal region (ARP35634_T100)
Your Rating
Aviva Travel Grant
Assay Development
Aviva HIS tag Deal
Aviva Blast Tool