- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PITX2 (ARP32431_P050) antibody |
---|
Tested Species Reactivity | Human | ||
---|---|---|---|
Predicted Species Reactivity | Human, Mouse, Guinea Pig, Horse | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | WB | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2 | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93% | ||
Peptide Sequence | Synthetic peptide located within the following region: METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-PITX2 (ARP32431_P050) antibody is Catalog # AAP32431 (Previous Catalog # AAPP03427) | ||
Sample Type Confirmation | PITX2 is supported by BioGPS gene expression data to be expressed in COLO205 | ||
Enhanced Validation |
| ||
Reference | Holmberg,J., (er) BMC Dev. Biol. 8, 25 (2008) |
Gene Symbol | PITX2 |
---|---|
Gene Full Name | Paired-like homeodomain 2 |
Alias Symbols | RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1 |
NCBI Gene Id | 5308 |
Protein Name | Pituitary homeobox 2 |
Description of Target | The PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. |
Uniprot ID | Q99697 |
Protein Accession # | NP_700475 |
Nucleotide Accession # | NM_153426 |
Protein Size (# AA) | 317 |
Molecular Weight | 35kDa |
Protein Interactions | LEF1; Hoxa1; WDR5; SMAD3; HDAC1; CTNNB1; ZNHIT3; TRIM25; HERC5; PDLIM1; PITX2; PROP1; KAT5; Pou1f1; MSX2; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Guinea Pig, Horse".
-
How long will it take to receive "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PITX2 Antibody - N-terminal region (ARP32431_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
This target may also be called "RS, RGS, ARP1, Brx1, IDG2, IGDS, IHG2, PTX2, RIEG, ASGD4, IGDS2, IRID2, Otlx2, RIEG1" in publications.
-
What is the shipping cost for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "35kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PITX2 Antibody - N-terminal region (ARP32431_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PITX2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PITX2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PITX2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PITX2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PITX2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PITX2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.