PITPNM3 Antibody - C-terminal region (ARP78584_P050)

Catalog No: ARP78584_P050

Host: Rabbit
Target Name: PITPNM3
Sample Tissue: Human ACHN Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PITPNM3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWAR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PITPNM3 (ARP78584_P050) antibody is Catalog # AAP78584

Target Info

• Gene Symbol: PITPNM3
• Gene Full Name: PITPNM family member 3
• Alias Symbols: NIR1, ACKR6, CORD5, RDGBA3
• NCBI Gene Id: 83394
• Protein Name: membrane-associated phosphatidylinositol transfer protein 3
• Description of Target: This gene encodes a member of a family of membrane-associated phosphatidylinositol transfer domain-containing proteins. The calcium-binding protein has phosphatidylinositol (PI) transfer activity and interacts with the protein tyrosine kinase PTK2B (also known as PYK2). The protein is homologous to a Drosophila protein that is implicated in the visual transduction pathway in flies. Mutations in this gene result in autosomal dominant cone dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9BZ71-2
• Protein Accession #: NP_112497.2
• Nucleotide Accession #: NM_031220.3
• Protein Size (# AA): 565
• Molecular Weight: 62 kDa