PIR Antibody - C-terminal region (ARP33664_T100)

Catalog No: ARP33664_T100

WB Suggested Anti-PIR Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Host: Rabbit
Target: PIR
Positive control (+): Human Liver (LI)
Negative control (-): 293T Cell Lysate (2T)
Antibody concentration: 5ug/ml

Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PIR
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PIR (ARP33664_T100) antibody is Catalog # AAP33664 (Previous Catalog # AAPS07810)
• Reference: Adams,M. (2005) J. Biol. Chem. 280 (31), 28675-28682

Target Info

• Gene Symbol: PIR
• Gene Full Name: Pirin (iron-binding nuclear protein)
• NCBI Gene Id: 8544
• Protein Name: Pirin
• Description of Target: PIR is a member of the cupin superfamily. The protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication.This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described.
• Uniprot ID: O00625
• Protein Accession #: NP_003653
• Nucleotide Accession #: NM_003662
• Protein Size (# AA): 290
• Molecular Weight: 32kDa
• Protein Interactions: SMAD9; UBL7; SPEN; SUGT1; STAM; PSMB2; PPP2CA; CLNS1A; ARHGDIA; NFIX; NFKBIA; BCL3;