Search Antibody, Protein, and ELISA Kit Solutions

PIP5K1A Antibody - middle region (ARP85959_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PIP5K1A
Official Gene Full Name:
phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
NCBI Gene Id:
8394
Protein Name:
phosphatidylinositol 4-phosphate 5-kinase type-1 alpha
Swissprot Id:
Q99755
Protein Accession #:
NP_001129108.1
Nucleotide Accession #:
NM_001135636.1
Description of Target:
Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety of cellular processes and is the substrate to form phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3), another second messenger. The majority of PtdIns(4,5)P2 is thought to occur via type I phosphatidylinositol 4-phosphate 5-kinases given the abundance of PtdIns4P. Participates in a variety of cellular processes such as actin cytoskeleton organization, cell adhesion, migration and phagocytosis. Required for membrane ruffling formation, actin organization and focal adhesion formation during directional cell migration by controlling integrin-induced translocation of RAC1 to the plasma membrane. Together with PIP5K1C is required for phagocytosis, but they regulate different types of actin remodeling at sequential steps. Promotes particle ingestion by activating WAS that induces Arp2/3 dependent actin polymerization at the nascent phagocytic cup. Together with PIP5K1B is required after stimulation of G-protein coupled receptors for stable platelet adhesion. Plays a role during calcium-induced keratinocyte differentiation. Recruited to the plasma membrane by the E-cadherin/beta-catenin complex where it provides the substrate PtdIns(4,5)P2 for the production of PtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphate that mobilize internal calcium and drive keratinocyte differentiation. Together with PIP5K1C have a role during embryogenesis. Functions also in the nucleus where acts as an activator of TUT1 adenylyltransferase activity in nuclear speckles, thereby regulating mRNA polyadenylation of a select set of mRNAs.
Protein Size (# AA):
562
Molecular Weight:
61 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PIP5K1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PIP5K1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PIP5K1A
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PIP5K1A (ARP85959_P050) antibody is Catalog # AAP85959
Datasheets/Manuals:
Printable datasheet for anti-PIP5K1A (ARP85959_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...