PIP5K Antibody (Phospho-Ser307) (OAAF07642)

Catalog No: OAAF07642 (Formerly GWB-ASB557)

Size:100 ug

Click here to learn more about Aviva's By-Request Conjugation Service.

Immunohistochemistry analysis of paraffin-embedded human brain, using PIP5K (Phospho-Ser307) Antibody. The picture on the right is blocked with the phospho peptide.

Immunofluorescence analysis of HeLa cells, using PIP5K (Phospho-Ser307) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry-Paraffin
• Additional Information: Modification Sites: Human:S307 Mouse:S318 Rat:S357
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human PIP5K around the phosphorylation site of Ser307.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: QSLIHPDSSNTPLSTRLVSVQEDAGKSPARNRSASITNLSLDRSGSPMVP
• Concentration: 1mg/ml
• Specificity: PIP5K (Phospho-Ser307) Antibody detects endogenous levels of PIP5K only when phosphorylated at Ser307.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  IF: 1:100~1:500
  ELISA: 1:10000

Target Info

• Gene Symbol: PIKFYVE
• Gene Full Name: phosphoinositide kinase, FYVE-type zinc finger containing
• Alias Symbols: 1-phosphatidylinositol 3-phosphate 5-kinase;CFD;epididymis luminal protein 37;FAB1;FYVE finger-containing phosphoinositide kinase;HEL37;phosphatidylinositol 3-phosphate 5-kinase type III;phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III;phosphoinositide kinase, FYVE finger containing;PIKfyve;PIP5K;PIP5K3;PIPkin-III;serine-protein kinase PIKFYVE;type III PIP kinase;ZFYVE29;zinc finger, FYVE domain containing 29.
• NCBI Gene Id: 200576
• Protein Name: 1-phosphatidylinositol 3-phosphate 5-kinase
• Description of Target: The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). Catalyzes the phosphorylation of phosphatidylinositol 3-phosphate on the fifth hydroxyl of the myo-inositol ring, to form phosphatidylinositol 3,5-bisphosphate. Required for endocytic-vacuolar pathway and nuclear migration. Plays a role in the biogenesis of endosome carrier vesicles (ECV)/ multivesicular bodies (MVB) transport intermediates from early endosomes.
• Uniprot ID: Q9Y2I7
• Molecular Weight: 237 kDa