ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: OAAL00400
Size:100 ug
Price: $349.00
SKU
OAAL00400
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PIK3R3 (OAAL00400) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid
ClonalityMonoclonal
Clone2F8
IsotypeIgG2a Kappa
HostMouse
ApplicationWB, FN
Reconstitution and StorageStore at -20C or lower. Aliquot to avoid repeated freezing and thawing.
ImmunogenPIK3R3 (AAH21622, 271 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Peptide SequenceSynthetic peptide located within the following region: HDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAF
FormulationIn 1x PBS, pH 7.4
Gene SymbolPIK3R3
Gene Full Namephosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Alias Symbolsp55, p55PIK, p55-GAMMA
NCBI Gene Id8503
Protein Accession #AAH21622
  1. What is the species homology for "PIK3R3 Antibody (OAAL00400)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PIK3R3 Antibody (OAAL00400)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "PIK3R3 Antibody (OAAL00400)" provided in?

    This item is provided in "Liquid".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PIK3R3 Antibody (OAAL00400)"?

    This target may also be called "p55, p55PIK, p55-GAMMA" in publications.

  5. What is the shipping cost for "PIK3R3 Antibody (OAAL00400)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PIK3R3 Antibody (OAAL00400)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PIK3R3 Antibody (OAAL00400)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PIK3R3 Antibody (OAAL00400)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PIK3R3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PIK3R3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PIK3R3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PIK3R3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PIK3R3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PIK3R3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PIK3R3 Antibody (OAAL00400)
Your Rating
We found other products you might like!