SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP46416_P050
Price: $0.00
SKU
ARP46416_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PIGQ (ARP46416_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PIGQ
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS
Concentration0.5 mg/ml
Blocking PeptideFor anti-PIGQ (ARP46416_P050) antibody is Catalog # AAP46416 (Previous Catalog # AAPS18106)
SubunitQ
ReferenceMartin,J., (2004) Nature 432 (7020), 988-994
Gene SymbolPIGQ
Gene Full NamePhosphatidylinositol glycan anchor biosynthesis, class Q
Alias SymbolsGPI1, DEE77, EIEE77, c407A10.1
NCBI Gene Id9091
Protein NamecDNA, FLJ95129, highly similar to Homo sapiens phosphatidylinositol glycan, class Q (PIGQ), transcript variant 2, mRNA EMBL BAG36993.1
Description of TargetPIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).
Uniprot IDQ9BRB3
Protein Accession #NP_004195
Nucleotide Accession #NM_004204
Protein Size (# AA)581
Molecular Weight65kDa
Protein InteractionsSMAD1; UBC; PIGC; PIGH; PIGA; PIGP;
  1. What is the species homology for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PIGQ Antibody - N-terminal region (ARP46416_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    This target may also be called "GPI1, DEE77, EIEE77, c407A10.1" in publications.

  5. What is the shipping cost for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PIGQ Antibody - N-terminal region (ARP46416_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PIGQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PIGQ"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PIGQ"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PIGQ"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PIGQ"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PIGQ"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PIGQ Antibody - N-terminal region (ARP46416_P050)
Your Rating
We found other products you might like!