- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PIAS2 (ARP53840_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PIAS2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 93%; Rabbit: 92%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PIAS2 (ARP53840_P050) antibody is Catalog # AAP53840 (Previous Catalog # AAPP30679) |
Reference | Tsang,H.T., (2006) Genomics 88 (3), 333-346 |
---|---|
Gene Symbol | PIAS2 |
Gene Full Name | Protein inhibitor of activated STAT, 2 |
Alias Symbols | DIP, MIZ1, SIZ2, ARIP3, PIASX, ZMIZ4 |
NCBI Gene Id | 9063 |
Protein Name | E3 SUMO-protein ligase PIAS2 |
Description of Target | Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described. |
Uniprot ID | O75928-2 |
Protein Accession # | NP_775298 |
Nucleotide Accession # | NM_173206 |
Protein Size (# AA) | 572 |
Molecular Weight | 63kDa |
Protein Interactions | HIC1; GOLGA2; GFAP; PHC1; TRIM23; ZBTB8A; SUMO1P1; ACY3; TSR2; NAV2; CCHCR1; CCNDBP1; MAPKAPK2; ZBED1; PIAS2; SUMO1; UBE2I; TP53; PRKAB2; MX2; TRIM63; TRIM55; CTBP1; GTF2I; SUMO2; SUMO3; MYC; DNMT3A; TICAM2; RUFY1; PIAS4; C1QA; ADA; PAXIP1; UBC; PLAGL1; P |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PIAS2 Antibody - N-terminal region (ARP53840_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
This target may also be called "DIP, MIZ1, SIZ2, ARIP3, PIASX, ZMIZ4" in publications.
-
What is the shipping cost for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "63kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PIAS2 Antibody - N-terminal region (ARP53840_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PIAS2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PIAS2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PIAS2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PIAS2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PIAS2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PIAS2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.