Catalog No: OPCA01287
Price: $0.00
SKU
OPCA01287
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for PHPT1 Recombinant Protein (Human) (OPCA01287) (OPCA01287) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Tag information : His tag |
Reconstitution and Storage | -20°C or -80°C |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Protein Sequence | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 1-125 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Identification and characterization of a mammalian 14-KDA phosphohistidine phosphatase.Ek P., Pettersson G., Ek B., Gong F., Li J.-P., Zetterqvist O.Eur. J. Biochem. 269:5016-5023(2002) |
---|---|
Gene Symbol | PHPT1 |
Gene Full Name | phosphohistidine phosphatase 1 |
Alias Symbols | 14 kDa phosphohistidine phosphatase;CGI-202;epididymis secretory sperm binding protein Li 132P;HEL-S-132P;HSPC141;Phosphohistidine phosphatase 1;PHP;PHP14;protein histidine phosphatase;protein janus-A homolog;sex-regulated protein janus-a. |
NCBI Gene Id | 29085 |
Protein Name | 14 kDa phosphohistidine phosphatase |
Description of Target | Exhibits phosphohistidine phosphatase activity. |
Uniprot ID | Q9NRX4 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 15.8 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!