PHOX2B Antibody - middle region (ARP97846_P050)

Catalog No: ARP97846_P050

Host: Rabbit
Target Name: PHOX2B
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHOX2B
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ATSGCPSLTPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PHOX2B (ARP97846_P050) antibody is Catalog # AAP97846

Target Info

• Gene Symbol: PHOX2B
• Gene Full Name: paired like homeobox 2b
• Alias Symbols: CCHS, PMX2B, NBLST2, NBPhox
• NCBI Gene Id: 8929
• Protein Name: paired mesoderm homeobox protein 2B
• Description of Target: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription factor involved in the development of several major noradrenergic neuron populations and the determination of neurotransmitter phenotype. The gene product is linked to enhancement of second messenger-mediated activation of the dopamine beta-hydroylase, c-fos promoters and several enhancers, including cyclic amp-response element and serum-response element. Expansion of a 20 amino acid polyalanine tract in this protein by 5-13 aa has been associated with congenital central hypoventilation syndrome.
• Uniprot ID: Q99453
• Protein Accession #: NP_003915.2
• Nucleotide Accession #: NM_003924.3
• Protein Size (# AA): 314
• Molecular Weight: 34 kDa