PHLPP2 Antibody - C-terminal region (ARP42429_P050)

Catalog No: ARP42429_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: PHLPP2
Sample Tissue: Human 786-0 Whole Cell lysates
Antibody Dilution: 2ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHLPP2
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PHLPP2 (ARP42429_P050) antibody is Catalog # AAP42429

Target Info

• Gene Symbol: PHLPP2
• Gene Full Name: PH domain and leucine rich repeat protein phosphatase 2
• Alias Symbols: PPM3B, PHLPPL
• NCBI Gene Id: 23035
• Protein Name: PH domain leucine-rich repeat-containing protein phosphatase 2
• Description of Target: Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser-657' of PRKCA. Akt regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of Akt triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylates STK4 on 'Thr-387' leading to STK4 activation and apoptosis. Dephosphorylates RPS6KB1 and is involved in regulation of cap-dependent translation. Inhibits cancer cell proliferation and may act as a tumor suppressor. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Dephosphorylates RAF1 inhibiting its kinase activity.
• Uniprot ID: Q6ZVD8-3
• Protein Accession #: NP_055835
• Nucleotide Accession #: NM_015020.3
• Protein Size (# AA): 1256
• Molecular Weight: 138 kDa
• Protein Interactions: UBC; USP12; WDR20; WDR48; PPP3CA; SNX27; USP46; PHLPP1; VAT1; SLC9A3R1; SLC9A3R2; EZR; USP1; RDX;