- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
PHLPP2 Antibody - C-terminal region (ARP42429_P050)
Datasheets/Manuals | Printable datasheet for anti-PHLPP2 (ARP42429_P050) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PHLPP2 |
Purification | Affinity purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: PVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PHLPP2 (ARP42429_P050) antibody is Catalog # AAP42429 |
Gene Symbol | PHLPP2 |
---|---|
Gene Full Name | PH domain and leucine rich repeat protein phosphatase 2 |
Alias Symbols | PPM3B, PHLPPL |
NCBI Gene Id | 23035 |
Protein Name | PH domain leucine-rich repeat-containing protein phosphatase 2 |
Description of Target | Protein phosphatase involved in regulation of Akt and PKC signaling. Mediates dephosphorylation in the C-terminal domain hydrophobic motif of members of the AGC Ser/Thr protein kinase family; specifically acts on 'Ser-473' of AKT1, 'Ser-660' of PRKCB isoform beta-II and 'Ser-657' of PRKCA. Akt regulates the balance between cell survival and apoptosis through a cascade that primarily alters the function of transcription factors that regulate pro- and antiapoptotic genes. Dephosphorylation of 'Ser-473' of Akt triggers apoptosis and decreases cell proliferation. Also controls the phosphorylation of AKT3. Dephosphorylates STK4 on 'Thr-387' leading to STK4 activation and apoptosis. Dephosphorylates RPS6KB1 and is involved in regulation of cap-dependent translation. Inhibits cancer cell proliferation and may act as a tumor suppressor. Dephosphorylation of PRKCA and PRKCB leads to their destabilization and degradation. Dephosphorylates RAF1 inhibiting its kinase activity. |
Uniprot ID | Q6ZVD8-3 |
Protein Accession # | NP_055835 |
Nucleotide Accession # | NM_015020.3 |
Protein Size (# AA) | 1256 |
Molecular Weight | 138 kDa |
Protein Interactions | UBC; USP12; WDR20; WDR48; PPP3CA; SNX27; USP46; PHLPP1; VAT1; SLC9A3R1; SLC9A3R2; EZR; USP1; RDX; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
This item is available "Domestic: within 24 hours delivery | International: 3-5 days".
-
What buffer format is "PHLPP2 Antibody - C-terminal region (ARP42429_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
This target may also be called "PPM3B, PHLPPL" in publications.
-
What is the shipping cost for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "138 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PHLPP2 Antibody - C-terminal region (ARP42429_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PHLPP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PHLPP2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PHLPP2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PHLPP2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PHLPP2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PHLPP2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.