Catalog No: OPCA29301
Price: $0.00
SKU
OPCA29301
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ PHLDA2 Recombinant Protein (Mouse) (OPCA29301)
Datasheets/Manuals | Printable datasheet for OPCA29301 |
---|
Predicted Species Reactivity | Mouse |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MASKIVMSSKTVKTSDEILCEGELEKRSDSLFQVWKKKRCVLTADRLRLFSGKTSPAKELFFHSILKVDCVEHTSKYVYFTIVTNYYKEIDFRCTVESCWNAAITMALIDFQNRRALQDFPRYRYQRSESEMPSEPGEQSALGP |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 1-144 |
Gene Full Name | pleckstrin homology like domain, family A, member 2 |
---|---|
Alias Symbols | Ipl, Tssc3 |
NCBI Gene Id | 22113 |
Protein Name | pleckstrin homology-like domain family A member 2 |
Description of Target | This gene is one of several genes in the imprinted gene domain on chromosome 7. Studies using knockout mice have shown that the product of this gene regulates placental growth. Transcripts from this gene are most abundant in placenta and yolk sac, and are |
Uniprot ID | O08969 |
Protein Accession # | NP_033460.1 |
Nucleotide Accession # | NM_009434.2 |
Protein Size (# AA) | 144 |
Write Your Own Review