Search Antibody, Protein, and ELISA Kit Solutions

PHLDA2 Antibody - middle region (ARP58237_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58237_P050-FITC Conjugated

ARP58237_P050-HRP Conjugated

ARP58237_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Pleckstrin homology-like domain, family A, member 2
NCBI Gene Id:
Protein Name:
Pleckstrin homology-like domain family A member 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-517086 from Santa Cruz Biotechnology.
Description of Target:
This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PHLDA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PHLDA2.
The immunogen is a synthetic peptide directed towards the middle region of human PHLDA2
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PHLDA2 (ARP58237_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PHLDA2 (ARP58237_P050) antibody is Catalog # AAP58237 (Previous Catalog # AAPP32836)
Printable datasheet for anti-PHLDA2 (ARP58237_P050) antibody
Sample Type Confirmation:

PHLDA2 is supported by BioGPS gene expression data to be expressed in HT1080


Dai, H. et al. TSSC3 overexpression associates with growth inhibition, apoptosis induction and enhances chemotherapeutic effects in human osteosarcoma. Carcinogenesis 33, 30-40 (2012). IHC, WB, Human 22021909

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...