PHLDA1 Antibody - middle region (ARP54809_P050)

Catalog No: ARP54809_P050

WB Suggested Anti-PHLDA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PHLDA1 (ARP54809_P050) antibody is Catalog # AAP54809 (Previous Catalog # AAPP31613)

Target Info

• Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56
• Gene Symbol: PHLDA1
• Gene Full Name: Pleckstrin homology-like domain, family A, member 1
• Alias Symbols: PHRIP, TDAG51, DT1P1B11
• NCBI Gene Id: 22822
• Protein Name: Pleckstrin homology-like domain family A member 1
• Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
• Uniprot ID: Q8WV24
• Protein Accession #: NP_031376
• Nucleotide Accession #: NM_007350
• Protein Size (# AA): 401
• Molecular Weight: 45kDa
• Protein Interactions: UBC; SUMO1; MDFI; EGFR; APP; DNAJB1; HSPB1; HSPA4; ELAVL1; KRTAP4-12; RPL14; PLSCR1; HSPA4L; EIF3D; PABPC4;