PHACTR3 Antibody - C-terminal region (ARP53447_P050)

Catalog No: ARP53447_P050

WB Suggested Anti-PHACTR3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PHACTR3 (ARP53447_P050) antibody is Catalog # AAP53447 (Previous Catalog # AAPP31970)

Target Info

• Reference: Worch,S., (2006) Cytogenet. Genome Res. 115 (1), 23-29
• Gene Symbol: PHACTR3
• Gene Full Name: Phosphatase and actin regulator 3
• Alias Symbols: H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101
• NCBI Gene Id: 116154
• Protein Name: Phosphatase and actin regulator 3
• Description of Target: PHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms.
• Uniprot ID: B1AN69
• Protein Accession #: NP_899069
• Nucleotide Accession #: NM_183246
• Protein Size (# AA): 448
• Molecular Weight: 51kDa
• Protein Interactions: PPP1CA; TAB1; MAPK6; EEF1G;