Catalog No: ARP53447_P050
Price: $0.00
SKU
ARP53447_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PHACTR3 Antibody - C-terminal region (ARP53447_P050)

Datasheets/ManualsPrintable datasheet for anti-PHACTR3 (ARP53447_P050) antibody
Product Info
ReferenceWorch,S., (2006) Cytogenet. Genome Res. 115 (1), 23-29
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PHACTR3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
Concentration0.5 mg/ml
Blocking PeptideFor anti-PHACTR3 (ARP53447_P050) antibody is Catalog # AAP53447 (Previous Catalog # AAPP31970)
Gene SymbolPHACTR3
Gene Full NamePhosphatase and actin regulator 3
Alias SymbolsH17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101
NCBI Gene Id116154
Protein NamePhosphatase and actin regulator 3
Description of TargetPHACTR3 is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1.The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms.
Uniprot IDB1AN69
Protein Accession #NP_899069
Nucleotide Accession #NM_183246
Protein Size (# AA)448
Molecular Weight51kDa
Protein InteractionsPPP1CA; TAB1; MAPK6; EEF1G;
  1. What is the species homology for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PHACTR3 Antibody - C-terminal region (ARP53447_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    This target may also be called "H17739, SCAPIN1, PPP1R123, SCAPININ, C20orf101" in publications.

  5. What is the shipping cost for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PHACTR3 Antibody - C-terminal region (ARP53447_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PHACTR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PHACTR3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PHACTR3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PHACTR3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PHACTR3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PHACTR3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PHACTR3 Antibody - C-terminal region (ARP53447_P050)
Your Rating
We found other products you might like!