- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for PGM2 Antibody (OAAL00723) |
---|
Predicted Species Reactivity | Human|Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 1A3 |
Isotype | IgG2a Kappa |
Host | Mouse |
Application | ELISA|WB |
Reconstitution and Storage | -20°C |
Immunogen | PGM2 (AAH10087.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | PGM2 |
---|---|
Gene Full Name | phosphoglucomutase 2 |
Alias Symbols | glucose phosphomutase 2, MSTP006, PGM 2, phosphodeoxyribomutase, phosphoglucomutase-2. |
NCBI Gene Id | 55276 |
Protein Name | Homo sapiens phosphoglucomutase 2, mRNA (cDNA clone MGC:19508 IMAGE:2964390), complete cds|Phosphoglucomutase 2 [Homo sapiens] |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/AAH10087.1 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/BC010087.2 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PGM2 Antibody (OAAL00723)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "PGM2 Antibody (OAAL00723)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "PGM2 Antibody (OAAL00723)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PGM2 Antibody (OAAL00723)"?
This target may also be called "glucose phosphomutase 2, MSTP006, PGM 2, phosphodeoxyribomutase, phosphoglucomutase-2." in publications.
-
What is the shipping cost for "PGM2 Antibody (OAAL00723)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PGM2 Antibody (OAAL00723)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PGM2 Antibody (OAAL00723)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PGM2 Antibody (OAAL00723)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PGM2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PGM2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PGM2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PGM2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PGM2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PGM2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.