PGBD2 Antibody - middle region : HRP (ARP54446_P050-HRP)

Catalog No: ARP54446_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Cow, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGBD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Rabbit: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PGBD2 (ARP54446_P050-HRP) antibody is Catalog # AAP54446 (Previous Catalog # AAPP31226)

Target Info

• Reference: Xiang,Z., (2001) Genomics 72 (1), 105-107
• Gene Symbol: PGBD2
• Gene Full Name: PiggyBac transposable element derived 2
• Alias Symbols: -
• NCBI Gene Id: 267002
• Protein Name: PiggyBac transposable element-derived protein 2
• Description of Target: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: B3KVR8
• Protein Accession #: NP_001017434
• Nucleotide Accession #: NM_001017434
• Protein Size (# AA): 341
• Molecular Weight: 39kDa