Catalog No: ARP56102_P050
Price: $0.00
SKU
ARP56102_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PEX5 Antibody - middle region (ARP56102_P050)

Datasheets/ManualsPrintable datasheet for anti-PEX5 (ARP56102_P050) antibody
Product Info
ReferenceMaynard,E.L. (2007) J. Mol. Biol. 368 (5), 1259-1266
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PEX5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL
Concentration0.5 mg/ml
Blocking PeptideFor anti-PEX5 (ARP56102_P050) antibody is Catalog # AAP56102 (Previous Catalog # AAPP38007)
Gene SymbolPEX5
Gene Full NamePeroxisomal biogenesis factor 5
Alias SymbolsPXR1, PBD2A, PBD2B, PTS1R, RCDP5, PTS1-BP
NCBI Gene Id5830
Protein NamePeroxisomal targeting signal 1 receptor
Description of TargetPEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD).
Uniprot IDP50542-3
Protein Accession #NP_000310
Nucleotide Accession #NM_000319
Protein Size (# AA)631
Molecular Weight70kDa
Protein InteractionsCAPRIN2; CCDC14; TOMM7; PRR13; GDPD5; ZNF772; EP400NL; TM6SF1; ACOT8; RPL14; MKRN3; S100A6; LDHB; RANBP6; GSTK1; ZADH2; TYSND1; HSDL2; ACAD11; LONP2; PECR; HSD17B4; HOXA7; EHHADH; ECH1; CRAT; CAT; BRCA1; ACOX1; DECR2; HACL1; DHRS4; ECI2; AGPS; GNPAT; UBC;
  1. What is the species homology for "PEX5 Antibody - middle region (ARP56102_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "PEX5 Antibody - middle region (ARP56102_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PEX5 Antibody - middle region (ARP56102_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PEX5 Antibody - middle region (ARP56102_P050)"?

    This target may also be called "PXR1, PBD2A, PBD2B, PTS1R, RCDP5, PTS1-BP" in publications.

  5. What is the shipping cost for "PEX5 Antibody - middle region (ARP56102_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PEX5 Antibody - middle region (ARP56102_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PEX5 Antibody - middle region (ARP56102_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PEX5 Antibody - middle region (ARP56102_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PEX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PEX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PEX5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PEX5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PEX5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PEX5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PEX5 Antibody - middle region (ARP56102_P050)
Your Rating
We found other products you might like!