PEX13 Antibody - C-terminal region (ARP64105_P050)

Catalog No: ARP64105_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-PEX13 Antibody
Titration: 1.0 ug/ml
Positive Control: Jurkat Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: SFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PEX13 (ARP64105_P050) antibody is Catalog # AAP64105

Target Info

• Gene Symbol: PEX13
• Gene Full Name: Peroxisomal biogenesis factor 13
• Alias Symbols: ZWS, NALD, PBD11A, PBD11B
• NCBI Gene Id: 5194
• Protein Name: Peroxisomal membrane protein PEX13
• Description of Target: This gene encodes a peroxisomal membrane protein that binds the type 1 peroxisomal targeting signal receptor via a SH3 domain located in the cytoplasm. Mutations and deficiencies in peroxisomal protein importing and peroxisome assembly lead to peroxisomal biogenesis disorders, an example of which is Zellweger syndrome.
• Uniprot ID: Q92968
• Protein Accession #: NP_002609
• Nucleotide Accession #: NM_002618
• Protein Size (# AA): 403
• Molecular Weight: 44kDa
• Protein Interactions: SPRR2A; Mbp; PEX5; PEX19; PEX14; PEX13; UBC; PEX7;