Catalog No: ARP55008_P050-FITC
Size:100ul
Price: $499.00
SKU
ARP55008_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-PES1 (ARP55008_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PES1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PES1 (ARP55008_P050-FITC) antibody is Catalog # AAP55008 (Previous Catalog # AAPP32269)
Sample Type Confirmation

PES1 is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceRohrmoser,M., (2007) Mol. Cell. Biol. 27 (10), 3682-3694
Gene SymbolPES1
Gene Full NamePescadillo ribosomal biogenesis factor 1
Alias SymbolsPES, NOP7
NCBI Gene Id23481
Protein NamePescadillo homolog
Description of TargetPES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.This gene encodes a protein that is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO00541
Protein Accession #NP_055118
Nucleotide Accession #NM_014303
Protein Size (# AA)588
Molecular Weight68kDa
Protein InteractionsUBC; RNF2; LZTFL1; BLMH; ARL2; HDAC11; WDR12; PES1; BOP1; WHSC1; NOC4L; NAP1L4; NAP1L1; UBD; CAND1; CUL3; SIRT7; MYC; SUMO2; SUMO1; tat; ARRB2; ARRB1;
  1. What is the species homology for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    This target may also be called "PES, NOP7" in publications.

  5. What is the shipping cost for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PES1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PES1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PES1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PES1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PES1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PES1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PES1 Antibody - C-terminal region : FITC (ARP55008_P050-FITC)
Your Rating
We found other products you might like!