PER2 Antibody - middle region (ARP39565_P050)

Catalog No: ARP39565_P050

Host: Rabbit
Target Name: PER2
Sample Type: Human Hela
Antibody Dilution: 1.0ug/ml

WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Placenta

Host: Rabbit
Target Name: PER2
Sample Tissue: Human THP-1 Whole Cell
Antibody Dilution: 2ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PER2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Horse: 79%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PER2 (ARP39565_P050) antibody is Catalog # AAP39565 (Previous Catalog # AAPP21578)
• Sample Type Confirmation:

  PER2 is supported by BioGPS gene expression data to be expressed in 721_B, Jurkat, MCF7

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Gery,S., (2007) Oncogene 26 (57), 7916-7920

Target Info

• Gene Symbol: PER2
• Gene Full Name: Period homolog 2 (Drosophila)
• Alias Symbols: FASPS, FASPS1
• NCBI Gene Id: 8864
• Protein Name: Period circadian protein homolog 2
• Description of Target: This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known.This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: O15055
• Protein Accession #: NP_073728
• Nucleotide Accession #: NM_022817
• Protein Size (# AA): 1255
• Molecular Weight: 137 kDa
• Protein Interactions: TPT1; TP53; MDM2; CRY1; BTRC; ELAVL1; UBC; Csnk1e; PER3; CRY2; TIMELESS; PER1; CSNK1D;