PELI1 Antibody - N-terminal region : Biotin (ARP57429_P050-Biotin)

Catalog No: ARP57429_P050-Biotin

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PELI1 (ARP57429_P050-Biotin) antibody is Catalog # AAP57429 (Previous Catalog # AAPP41426)
• Sample Type Confirmation:

  PELI1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: PELI1
• Gene Full Name: Pellino E3 ubiquitin protein ligase 1
• Alias Symbols: DKFZp686C18116, MGC50990
• NCBI Gene Id: 57162
• Protein Name: E3 ubiquitin-protein ligase pellino homolog 1
• Description of Target: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.
• Uniprot ID: Q8C669
• Protein Accession #: NP_065702
• Nucleotide Accession #: NM_020651
• Protein Size (# AA): 418
• Molecular Weight: 46kDa
• Protein Interactions: UBC; VAC14; TRIP13; BCL6; SRPK2; SRPK1; DEAF1; IRAK1; UBE2V1; UBE2N; UBE2D2; UBE2D1; IRAK4; TRAF6; NR2C2; MYD88; SMAD6; IL1R1; TBK1; IKBKB; UBE2I; RIPK1; IRAK2;