Catalog No: ARP57429_P050
Price: $0.00
SKU
ARP57429_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PELI1 (ARP57429_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PELI1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
Concentration0.5 mg/ml
Blocking PeptideFor anti-PELI1 (ARP57429_P050) antibody is Catalog # AAP57429 (Previous Catalog # AAPP41426)
Sample Type Confirmation

PELI1 is supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolPELI1
Gene Full NamePellino E3 ubiquitin protein ligase 1
Alias SymbolsDKFZp686C18116, MGC50990
NCBI Gene Id57162
Protein NameE3 ubiquitin-protein ligase pellino homolog 1
Description of TargetPELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.
Uniprot IDQ8C669
Protein Accession #NP_065702
Nucleotide Accession #NM_020651
Protein Size (# AA)418
Molecular Weight46kDa
Protein InteractionsUBC; VAC14; TRIP13; BCL6; SRPK2; SRPK1; DEAF1; IRAK1; UBE2V1; UBE2N; UBE2D2; UBE2D1; IRAK4; TRAF6; NR2C2; MYD88; SMAD6; IL1R1; TBK1; IKBKB; UBE2I; RIPK1; IRAK2;
  1. What is the species homology for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PELI1 Antibody - N-terminal region (ARP57429_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    This target may also be called "DKFZp686C18116, MGC50990" in publications.

  5. What is the shipping cost for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PELI1 Antibody - N-terminal region (ARP57429_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PELI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PELI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PELI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PELI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PELI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PELI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PELI1 Antibody - N-terminal region (ARP57429_P050)
Your Rating