Protein on Demand™ PEA15A Recombinant Protein (Mouse) (OPCA271545)

Datasheets/Manuals	Printable datasheet for OPCA271545

Product Info
Predicted Species Reactivity	Mouse
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-130

Gene Full Name	phosphoprotein enriched in astrocytes 15A
Alias Symbols	Mat1, Pea15, PEA-15, Pkcs15
NCBI Gene Id	18611
Protein Name	astrocytic phosphoprotein PEA-15
Description of Target	This gene encodes an adaptor protein that functions as a negative regulator of apoptosis induced by tumor necrosis factor-alpha, tumor necrosis factor-related apoptosis-inducing ligand, and Fas, through its interaction with fas-associated protein with dea
Uniprot ID	Q62048
Protein Size (# AA)	130