PEA-15 Antibody (Phospho-Ser116) (OAAF07424)

Catalog No: OAAF07424 (Formerly GWB-ASB201)

Size:100 ug

Western blot analysis of lysates from COS7 cells treated with INSULIN 0.01U/ML 15', using PEA-15 (Phospho-Ser116) Antibody. The lane on the right is blocked with the phospho peptide.

Immunohistochemistry analysis of paraffin-embedded human skeletal muscle, using PEA-15 (Phospho-Ser116) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Monkey|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:S116 Mouse:S116 Rat:S116
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human PEA-15 around the phosphorylation site of Ser116.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: DYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
• Concentration: 1mg/ml
• Specificity: PEA-15 (Phospho-Ser116) Antibody detects endogenous levels of PEA-15 only when phosphorylated at Ser116.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info: WB: 1:500~1:1000
  IHC: 1:50~1:100
  ELISA: 1:1000

Target Info

• Gene Symbol: PEA15
• Gene Full Name: proliferation and apoptosis adaptor protein 15
• Alias Symbols: 15 kDa phosphoprotein enriched in astrocytes;astrocytic phosphoprotein PEA-15;HMAT1;homolog of mouse MAT-1 oncogene;HUMMAT1H;mammary transforming gene 1, mouse, homolog of;MAT1;MAT1H;PEA-15;PED;PED/PEA15;PED-PEA15;phosphoprotein enriched in astrocytes 15;phosphoprotein enriched in diabetes;proliferation and apoptosis adaptor 15.
• NCBI Gene Id: 8682
• Protein Name: Astrocytic phosphoprotein PEA-15
• Description of Target: Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.
• Uniprot ID: Q15121
• Molecular Weight: 15 kDa