Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP53615_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP53615_P050-FITC Conjugated

ARP53615_P050-HRP Conjugated

ARP53615_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-390082 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 92%; Sheep: 100%
Complete computational species homology data Anti-PDXK (ARP53615_P050)
Peptide Sequence Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PDXK (ARP53615_P050) antibody is Catalog # AAP53615 (Previous Catalog # AAPP30455)
Datasheets/Manuals Printable datasheet for anti-PDXK (ARP53615_P050) antibody
Target Reference Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194
Gene Symbol PDXK
Official Gene Full Name Pyridoxal (pyridoxine, vitamin B6) kinase
Alias Symbols C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
NCBI Gene Id 8566
Protein Name Pyridoxal kinase
Description of Target PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id O00764
Protein Accession # NP_003672
Nucleotide Accession # NM_003681
Protein Size (# AA) 312
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PDXK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PDXK.
Protein Interactions UBC; SUMO1; NEDD8; YWHAQ; BARD1; CAND1; COPS5; CUL1; CUL3; ELAVL1;
Write Your Own Review
You're reviewing:PDXK Antibody - N-terminal region (ARP53615_P050)
Your Rating