Search Antibody, Protein, and ELISA Kit Solutions

PDXK antibody - N-terminal region (ARP53615_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53615_P050-FITC Conjugated

ARP53615_P050-HRP Conjugated

ARP53615_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Pyridoxal (pyridoxine, vitamin B6) kinase
Protein Name:
Pyridoxal kinase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
Replacement Item:
This antibody may replace item sc-390082 from Santa Cruz Biotechnology.
Description of Target:
PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDXK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDXK.
The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 92%; Sheep: 100%
Complete computational species homology data:
Anti-PDXK (ARP53615_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PDXK (ARP53615_P050) antibody is Catalog # AAP53615 (Previous Catalog # AAPP30455)
Printable datasheet for anti-PDXK (ARP53615_P050) antibody
Target Reference:
Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...