Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PDXK antibody - N-terminal region (ARP53615_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP53615_P050-FITC Conjugated

ARP53615_P050-HRP Conjugated

ARP53615_P050-Biotin Conjugated

Gene Symbol:
PDXK
NCBI Gene Id:
8566
Official Gene Full Name:
Pyridoxal (pyridoxine, vitamin B6) kinase
Protein Name:
Pyridoxal kinase
Swissprot Id:
O00764
Protein Accession #:
NP_003672
Nucleotide Accession #:
NM_003681
Alias Symbols:
C21orf124, C21orf97, DKFZp566A071, FLJ31940, FLJ37311, MGC15873, MGC31754, MGC52346, PKH, PNK, PRED79
Replacement Item:
This antibody may replace item sc-390082 from Santa Cruz Biotechnology.
Description of Target:
PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
312
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDXK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDXK.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 92%; Sheep: 100%
Complete computational species homology data:
Anti-PDXK (ARP53615_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; SUMO1; NEDD8; YWHAQ; BARD1; CAND1; COPS5; CUL1; CUL3; ELAVL1;
Blocking Peptide:
For anti-PDXK (ARP53615_P050) antibody is Catalog # AAP53615 (Previous Catalog # AAPP30455)
Datasheets/Manuals:
Printable datasheet for anti-PDXK (ARP53615_P050) antibody
Target Reference:
Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194

Tell us what you think about this item!

Write A Review
    Please, wait...