Catalog No: ARP53616_P050
Price: $0.00
SKU
ARP53616_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PDXK Antibody - middle region (ARP53616_P050)

Datasheets/ManualsPrintable datasheet for anti-PDXK (ARP53616_P050) antibody
Product Info
ReferenceMusayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PDXK
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDXK (ARP53616_P050) antibody is Catalog # AAP53616 (Previous Catalog # AAPP30456)
Gene SymbolPDXK
Gene Full NamePyridoxal (pyridoxine, vitamin B6) kinase
Alias SymbolsPKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124
NCBI Gene Id8566
Protein NamePyridoxal kinase
Description of TargetPDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO00764
Protein Accession #NP_003672
Nucleotide Accession #NM_003681
Protein Size (# AA)312
Molecular Weight34kDa
Protein InteractionsUBC; SUMO1; NEDD8; YWHAQ; BARD1; CAND1; COPS5; CUL1; CUL3; ELAVL1;
  1. What is the species homology for "PDXK Antibody - middle region (ARP53616_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PDXK Antibody - middle region (ARP53616_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDXK Antibody - middle region (ARP53616_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PDXK Antibody - middle region (ARP53616_P050)"?

    This target may also be called "PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124" in publications.

  5. What is the shipping cost for "PDXK Antibody - middle region (ARP53616_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDXK Antibody - middle region (ARP53616_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDXK Antibody - middle region (ARP53616_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDXK Antibody - middle region (ARP53616_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDXK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDXK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDXK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDXK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDXK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDXK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDXK Antibody - middle region (ARP53616_P050)
Your Rating
We found other products you might like!