Catalog No: ARP58313_P050-Biotin
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PDS5B (ARP58313_P050-Biotin) antibody
Product Info
ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PDS5B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK
Concentration0.5 mg/ml
Blocking PeptideFor anti-PDS5B (ARP58313_P050-Biotin) antibody is Catalog # AAP58313 (Previous Catalog # AAPP32923)
Sample Type Confirmation

PDS5B is strongly supported by BioGPS gene expression data to be expressed in 721_B

Gene SymbolPDS5B
Gene Full NamePDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Alias SymbolsAS3, APRIN, CG008
NCBI Gene Id23047
Protein NameSister chromatid cohesion protein PDS5 homolog B
Description of TargetPDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.
Uniprot IDQ9NTI5
Protein Accession #NP_055847
Nucleotide Accession #NM_015032
Protein Size (# AA)1447
Molecular Weight159kDa
Protein InteractionsUBC; EED; RNF2; CDCA5; LAMP2; APP; NSMCE2; SIRT7; RAD21; STAG2; STAG1; SMC3; SMC1A; SUMO1; WAPAL; WFDC5; PDS5A; tat;
  1. What is the species homology for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    This target may also be called "AS3, APRIN, CG008" in publications.

  5. What is the shipping cost for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "159kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PDS5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PDS5B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PDS5B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PDS5B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PDS5B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PDS5B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PDS5B Antibody - middle region : Biotin (ARP58313_P050-Biotin)
Your Rating
We found other products you might like!