Search Antibody, Protein, and ELISA Kit Solutions

PDPK1 Antibody - C-terminal region (ARP74718_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PDPK1
Official Gene Full Name:
3-phosphoinositide dependent protein kinase 1
NCBI Gene Id:
5170
Protein Name:
3-phosphoinositide-dependent protein kinase 1
Swissprot Id:
O15530-2
Protein Accession #:
NP_001248745.1
Nucleotide Accession #:
NM_001261816.1
Alias Symbols:
PDK1, PDPK2, PDPK2P, PRO0461,
Replacement Item:
This antibody may replace item sc-136243 from Santa Cruz Biotechnology.
Protein Size (# AA):
506
Molecular Weight:
55 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDPK1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDPK1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PDPK1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PDPK1 (ARP74718_P050) antibody is Catalog # AAP74718
Datasheets/Manuals:
Printable datasheet for anti-PDPK1 (ARP74718_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...