Search Antibody, Protein, and ELISA Kit Solutions

PDLIM2 Antibody - N-terminal region : FITC (ARP75739_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75739_P050 Unconjugated

ARP75739_P050-HRP Conjugated

ARP75739_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
PDLIM2
Official Gene Full Name:
PDZ and LIM domain 2
NCBI Gene Id:
64236
Protein Name:
PDZ and LIM domain protein 2
Swissprot Id:
Q96JY6
Alias Symbols:
SLIM, MYSTIQUE
Description of Target:
This gene encodes a member of the ALP subfamily of PDZ-LIM domain proteins. The encoded protein suppresses anchorage-dependent growth and promotes cell migration and adhesion through interactions with the actin cytoskeleton via the PDZ domain. The encoded protein is also a putative tumor suppressor protein, and decreased expression of this gene is associated with several malignancies including breast cancer and adult T-cell leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Protein Size (# AA):
352
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDLIM2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDLIM2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDLI2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LHAEAQSKIRQSPSPLRLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ACD; POT1; UBC; RELA;
Blocking Peptide:
For anti-PDLIM2 (ARP75739_P050-FITC) antibody is Catalog # AAP75739
Datasheets/Manuals:
Printable datasheet for anti-PDLIM2 (ARP75739_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...