PDK1 Antibody - middle region (ARP88939_P050)

Catalog No: ARP88939_P050

Host: Rabbit
Target Name: PDK1
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of mouse PDK1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QYFLDRFYMSRISIRMLLNQHSLLFGGKGSPSHRKHIGSINPNCDVVEVI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDK1 (ARP88939_P050) antibody is Catalog # ARP88939_P050

Target Info

• Gene Symbol: PDK1
• Gene Full Name: pyruvate dehydrogenase kinase, isoenzyme 1
• Alias Symbols: B830012B01, D530020C15Rik
• NCBI Gene Id: 228026
• Protein Name: [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial
• Description of Target: Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Plays an important role in cellular responses to hypoxia and is important for cell proliferation under hypoxia. Protects cells against apoptosis in response to hypoxia and oxidative stress (By similarity).
• Uniprot ID: Q8BFP9
• Protein Accession #: NP_766253.2
• Nucleotide Accession #: NM_172665.5
• Protein Size (# AA): 434
• Molecular Weight: 47 kDa