PDK1 Antibody - middle region (ARP31776_P050)

Catalog No: ARP31776_P050

WB Suggested Anti-PDK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate

Host: Rabbit
Target Name: CHAD
Sample Type: Human Adult Placenta
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: PDK2
Sample Type: Human Jurkat
Antibody Dilution: 1.0ug/mlPDK1 is supported by BioGPS gene expression data to be expressed in Jurkat

Host: Rabbit
Target Name: PDK1
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

Host: Mouse
Target Name: PDK1
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%; Yeast: 90%
• Peptide Sequence: Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDK1 (ARP31776_P050) antibody is Catalog # AAP31776 (Previous Catalog # AAPP02567)
• Sample Type Confirmation:

  PDK1 is supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Ohba,T., (2008) Biochem. Biophys. Res. Commun. 369 (2), 376-381

Target Info

• Gene Symbol: PDK1
• Gene Full Name: Pyruvate dehydrogenase kinase, isozyme 1
• Alias Symbols: -
• NCBI Gene Id: 5163
• Protein Name: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial
• Description of Target: Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q15118
• Protein Accession #: NP_002601
• Nucleotide Accession #: NM_002610
• Protein Size (# AA): 436
• Molecular Weight: 47kDa
• Protein Interactions: EGFR; PDK1; KAT2B; USP4; UBC; MYC; XRCC6; SGK1; DLAT; RPS6KB1; PDK2; PDHA1; YWHAQ; RPTOR; RALGDS; PKN2; PKN1; MTOR; AKT1;