Search Antibody, Protein, and ELISA Kit Solutions

PDIA6 Antibody - N-terminal region : FITC (ARP52102_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52102_P050 Unconjugated

ARP52102_P050-HRP Conjugated

ARP52102_P050-Biotin Conjugated

Gene Symbol:
PDIA6
Official Gene Full Name:
Protein disulfide isomerase family A, member 6
NCBI Gene Id:
10130
Protein Name:
Protein disulfide-isomerase A6
Swissprot Id:
Q922R8
Protein Accession #:
NP_005733
Nucleotide Accession #:
NM_005742
Alias Symbols:
ERP5, P5, TXNDC7
Replacement Item:
This antibody may replace item sc-158492 from Santa Cruz Biotechnology.
Description of Target:
Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.
Protein Size (# AA):
440
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, IP, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PDIA6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PDIA6.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PDIA6
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 79%; Rat: 100%
Complete computational species homology data:
Anti-PDIA6 (ARP52102_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
HUWE1; UBC; MDM2; P3H1; XPO5; MAT2B; NRD1; GTF2A1; C1QBP; ARPC4; UGDH; TPD52L2; TPD52; PPP3CA; PFDN5; PCYT1A; PARK2; UBD; ADRB2; IGSF8; CD81; MTNR1A; FN1; CSNK2A1; CASP8; METTL23; GRDX; gag-pol; CLN8; VKORC1; SMURF1; TXNL1; MACF1; TPI1; PMS2P1; P4HB; IGBP
Blocking Peptide:
For anti-PDIA6 (ARP52102_P050-FITC) antibody is Catalog # AAP52102 (Previous Catalog # AAPP33643)
Datasheets/Manuals:
Printable datasheet for anti-PDIA6 (ARP52102_P050-FITC) antibody
Sample Type Confirmation:

PDIA6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...