PDGFR beta Antibody (Phospho-Tyr1021) (OAAF07589)

Catalog No: OAAF07589 (Formerly GWB-ASB453)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human brain, using PDGFR beta (Phospho-Tyr1021) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse|Rat
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
• Additional Information: Modification Sites: Human:Y1021 Mouse:Y1020 Rat:Y1020
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human PDGFR beta around the phosphorylation site of Tyr1021.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: RLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEG
• Concentration: 1mg/ml
• Specificity: PDGFR beta (Phospho-Tyr1021) Antibody detects endogenous levels of PDGFR beta only when phosphorylated at Tyr1021.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  ELISA: 1:1000

Target Info

• Gene Symbol: PDGFRB
• Gene Full Name: platelet derived growth factor receptor beta
• Alias Symbols: Activated tyrosine kinase PDGFRB;Beta platelet-derived growth factor receptor;beta-type platelet-derived growth factor receptor;CD140 antigen-like family member B;CD140B;IBGC4;IMF1;JTK12;KOGS;NDEL1-PDGFRB;PDGFR;PDGFR1;PDGFR-1;PDGFR-beta;PDGF-R-beta;PENTT;platelet-derived growth factor receptor 1;platelet-derived growth factor receptor beta;platelet-derived growth factor receptor, beta polypeptide.
• NCBI Gene Id: 5159
• Protein Name: Platelet-derived growth factor receptor beta
• Description of Target: Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, differentiation, chemotaxis and migration. Plays an essential role in blood vessel development by promoting proliferation, migration and recruitment of pericytes and smooth muscle cells to endothelial cells. Plays a role in the migration of vascular smooth muscle cells and the formation of neointima at vascular injury sites. Required for normal development of the cardiovascular system. Required for normal recruitment of pericytes (mesangial cells) in the kidney glomerulus, and for normal formation of a branched network of capillaries in kidney glomeruli. Promotes rearrangement of the actin cytoskeleton and the formation of membrane ruffles. Binding of its cognate ligands - homodimeric PDGFB, heterodimers formed by PDGFA and PDGFB or homodimeric PDGFD -leads to the activation of several signaling cascades; the response depends on the nature of the bound ligand and is modulated by the formation of heterodimers between PDGFRA and PDGFRB. Phosphorylates PLCG1, PIK3R1, PTPN11, RASA1/GAP, CBL, SHC1 and NCK1. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate, mobilization of cytosolic Ca(2+) and the activation of protein kinase C. Phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leads to the activation of the AKT1 signaling pathway. Phosphorylation of SHC1, or of the C-terminus of PTPN11, creates a binding site for GRB2, resulting in the activation of HRAS, RAF1 and down-stream MAP kinases, including MAPK1/ERK2 and/or MAPK3/ERK1. Promotes phosphorylation and activation of SRC family kinases. Promotes phosphorylation of PDCD6IP/ALIX and STAM. Receptor signaling is down-regulated by protein phosphatases that dephosphorylate the receptor and its down-stream effectors, and by rapid internalization of the activated receptor.
• Uniprot ID: P09619
• Molecular Weight: 123 kDa