PDGFD Antibody - N-terminal region (ARP90474_P050)

Catalog No: ARP90474_P050

Host: Rabbit
Target Name: PDGFD
Sample Tissue: Mouse Testis lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PDGFD
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALRNANLRRDESNHLTDLYQREENIQVTSNGHVQSPRFPNSYPRNLLLTW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PDGFD (ARP90474_P050) antibody is Catalog # AAP90474

Target Info

• Gene Symbol: PDGFD
• Gene Full Name: platelet-derived growth factor, D polypeptide
• Alias Symbols: 1110003I09Rik
• NCBI Gene Id: 71785
• Protein Name: platelet-derived growth factor D
• Description of Target: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Plays an important role in wound healing (By similarity). Has oncogenic potential and can induce tumor formation. Induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis. Can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix.
• Uniprot ID: Q925I7
• Protein Accession #: NP_082200.1
• Nucleotide Accession #: NM_027924.2
• Protein Size (# AA): 370
• Molecular Weight: 40 kDa